PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family BBR-BPC
Protein Properties Length: 228aa    MW: 25063.7 Da    PI: 10.4518
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12320genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind271.44.8e-8366227133301
                  GAGA_bind 133 ealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCt 216
                                ++ +iee   ++ke  k kkr++++ p ++kakk++k    +k++++ +   + +k +kk++ l +ng+++D+s+lPvPvCsCt
  Tp57577_TGAC_v2_mRNA12320  66 NVDEIEE-LAVKKEGGKAKKRKSKAAPTTPKAKKPRK----QKDNSNVS--GQGVKPPKKTVALEINGIEMDISGLPVPVCSCT 142
                                2222222.23333334444444444444444444444....22222333..3679***************************** PP

                  GAGA_bind 217 GalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvti 300
                                G ++qCY+WG+GGWqSaCCtt++S+yPLP+s krrgaRiagrKmSqgafkk+LekLaa+Gy+++n++DLk+hWA+HGtnkfvti
  Tp57577_TGAC_v2_mRNA12320 143 GNPQQCYRWGCGGWQSACCTTNVSIYPLPMSVKRRGARIAGRKMSQGAFKKVLEKLAAQGYNFANAIDLKTHWARHGTNKFVTI 226
                                ************************************************************************************ PP

                  GAGA_bind 301 r 301
                                r
  Tp57577_TGAC_v2_mRNA12320 227 R 227
                                8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.4E-1031227IPR010409GAGA-binding transcriptional activator
PfamPF062177.3E-8714227IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEXXXXAAVE SSNPLNYGRD NWINQRPRFY NMQVNNPNYA VPPETSQGPS FPFIPSAVTD  60
PPRNENVDEI EELAVKKEGG KAKKRKSKAA PTTPKAKKPR KQKDNSNVSG QGVKPPKKTV  120
ALEINGIEMD ISGLPVPVCS CTGNPQQCYR WGCGGWQSAC CTTNVSIYPL PMSVKRRGAR  180
IAGRKMSQGA FKKVLEKLAA QGYNFANAID LKTHWARHGT NKFVTIR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1420721e-174BT142072.1 Medicago truncatula clone JCVI-FLMt-4L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158817.11e-115hypothetical protein PHAVU_002G184500g
SwissprotQ9SKD03e-83BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLV7CPG31e-115V7CPG3_PHAVU; Uncharacterized protein
STRINGGLYMA08G09780.21e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23703283
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.33e-73basic pentacysteine 2